PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31640.1
Common NameF28M20.170, REM5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 352aa    MW: 40075.4 Da    PI: 9.6612
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31640.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B365.57.8e-2122981195
                 HHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
           B3 11 lksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                 +ks+ + +p kf+++h +gk +e+ t+ l++ +s r+W+vk+  ++++    lt+GWkeFv+a++L++gDfvvFk++g++ f  +v+
  AT4G31640.1 22 FKSH-IKIPVKFFSKHiEGK-HEGNTVYLRSyPSRRTWKVKM--EGHK----LTEGWKEFVEAHDLRVGDFVVFKHKGDMLF--HVT 98
                 6666.99*********7555.5677*****************..6666....***********************9998888..665 PP

2B373.13.3e-23152246299
                  EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  f++ +++++l+++++ +p++fa+++g++  ++ +++l+de+g++We ++  + ksgr+++++GW + + an+L++gD+++Fkl ++  + +v++++++
  AT4G31640.1 152 FSQSVTASNLTRDLVGIPRDFAKRYGLNIGRH-EIVLMDEEGNTWESEV-KSYKSGRVFIAGGWTSLCTANKLEVGDSCTFKLLRN-PKIPVFRLCSR 246
                  678899*******************9997665.****************.47777889************************9985.44489999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.1E-248105IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-229109IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.63411103IPR003340B3 DNA binding domain
CDDcd100172.66E-2012100No hitNo description
SMARTSM010191.6E-2514103IPR003340B3 DNA binding domain
PfamPF023624.0E-152495IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.8E-23144244IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.3E-23145244IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.579151246IPR003340B3 DNA binding domain
CDDcd100172.85E-20151245No hitNo description
SMARTSM010191.1E-29152247IPR003340B3 DNA binding domain
PfamPF023624.8E-22152246IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MKNPTLFAPK SPHFFQPILP GFKSHIKIPV KFFSKHIEGK HEGNTVYLRS YPSRRTWKVK  60
MEGHKLTEGW KEFVEAHDLR VGDFVVFKHK GDMLFHVTAI GPSCCEVQYA PSRSHDRNEE  120
SDEIGESSRN EKIIEENVKT EPDQFSPDLT CFSQSVTASN LTRDLVGIPR DFAKRYGLNI  180
GRHEIVLMDE EGNTWESEVK SYKSGRVFIA GGWTSLCTAN KLEVGDSCTF KLLRNPKIPV  240
FRLCSRPKAG AEARPHKRSR VQSSSGGSRQ KHDVRQKLDE EGGPSRCTRS SNKATGDQEK  300
LQQTQSCFIF DHVAKVKQSV EDTLNSIRRF RAKLETKEHN LEALLQETKT KL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306891020.0
Expression AtlasAT4G31640-
AtGenExpressAT4G31640-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4410740.0AJ441074.1 Arabidopsis thaliana mRNA for putative auxin response factor 22 (arf22 gene).
GenBankAY1425310.0AY142531.1 Arabidopsis thaliana unknown protein (At4g31640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194892.10.0B3 domain-containing protein REM5
SwissprotQ9SB800.0REM5_ARATH; B3 domain-containing protein REM5
TrEMBLV4MMK31e-115V4MMK3_EUTSA; Uncharacterized protein (Fragment)
STRINGAT4G31640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  2. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]